[Gly22]-β-Amyloid (1-40), Arctic Mutation

[Gly22]-β-Amyloid (1-40), Arctic Mutation

β-Amyloid peptides are the major constituents of senile plaques and neurofibrillary tangles that occur in the hippocampus, neocortex, and amygdala of patients with Alzheimer′s disease. Aβ (1-40) whether soluble or insoluble differentiates AD vs high pathology controls. The Arctic mutation E22G causes early onset of Alzheimer′s compared to wild type and promotes protofibril formation and neurotoxicity.
RP30250
¥20,844.00

Ask us a question
Overview
Description β-Amyloid peptides are the major constituents of senile plaques and neurofibrillary tangles that occur in the hippocampus, neocortex, and amygdala of patients with Alzheimer′s disease. Aβ (1-40) whether soluble or insoluble differentiates AD vs high pathology controls. The Arctic mutation E22G causes early onset of Alzheimer′s compared to wild type and promotes protofibril formation and neurotoxicity.
Sequence
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}
{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gly}{Asp}{Val}
{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}
{Gly}{Gly}{Val}{Val}
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
Molecular Weight 4257.76

Properties
Purity >95%
Solubility Soluble in Formic acid under 1mg/ml
Form Lyophilized
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.