BAGE cDNA ORF clone, Homo sapiens(human)

Gene
Clones
gRNAs

Summary

Gene Symbol	BAGE
Entrez Gene ID	574
Full Name	B melanoma antigen
Synonyms	BAGE1,CT2.1
General protein information	Preferred Names B melanoma antigen Names B melanoma antigen 1 antigen MZ2-BA cancer/testis antigen 2.1 cancer/testis antigen family 2, member 1
Gene Type	protein-coding
Organism	Homo sapiens(human)
Genome	Chromosome: 21 Map Location: 21p11.1
Summary	This gene encodes a tumor antigen recognized by autologous cytolytic lymphocytes (CTL). [provided by RefSeq, Jul 2008].
Disorder MIM:	605167

mRNA and Protein(s)

mRNA	Protein	Name
NM_001187.1	NP_001178.1	B melanoma antigen 1 precursor

Pathways from BioSystems
Gene Ontology
Bibliography

Related articles in PubMed

Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.
Zhang S, Zhou X, Yu H, Yu Y
BMC cancer10163(2010 Apr)

BAGE hypomethylation, a new epigenetic biomarker for colon cancer detection.
Grunau C, Brun ME, Rivals I, Selves J, Hindermann W, Favre-Mercuret M, Granier G, De Sario A
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology17(6)1374-9(2008 Jun)

Frequent DNA hypomethylation of human juxtacentromeric BAGE loci in cancer.
Grunau C, Sanchez C, Ehrlich M, van der Bruggen P, Hindermann W, Rodriguez C, Krieger S, Dubeau L, Fiala E, De Sario A
Genes, chromosomes & cancer43(1)11-24(2005 May)

BAGE genes generated by juxtacentromeric reshuffling in the Hominidae lineage are under selective pressure.
Ruault M, Ventura M, Galtier N, Brun ME, Archidiacono N, Roiz?s G, De Sario A
Genomics81(4)391-9(2003 Apr)

New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.
Ruault M, van der Bruggen P, Brun ME, Boyle S, Roiz?s G, De Sario A
European journal of human genetics : EJHG10(12)833-40(2002 Dec)

GeneRIFs: Gene References Into Functions What's a GeneRIF?

Tumor-specific antigen BAGE may play a role in the occurrence and development of ovarian cancer and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer.
Title: Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.

BAGE loci were hypomethylated in 81% of colorectal carcinoma samples.
Title: BAGE hypomethylation, a new epigenetic biomarker for colon cancer detection.

five new BAGE genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 and nine BAGE gene fragments mapping to the juxtacentromeric regions of chromosomes 9, 13, 18, and 21
Title: New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.

The following BAGE gene cDNA ORF clone sequences were retrieved from the NCBI Reference Sequence Database (RefSeq). These sequences represent the protein coding region of the BAGE cDNA ORF which is encoded by the open reading frame (ORF) sequence. ORF sequences can be delivered in our standard vector, pcDNA3.1⁺/C-(K)DYK or the vector of your choice as an expression/transfection-ready ORF clone. Not the clone you want? Click here to find your clone.

***CloneID	Accession No.	Definition	**Vector	*Turnaround time	Price (USD)	Select
OHu29352	NM_001187.1 Latest version!	Homo sapiens B melanoma antigen (BAGE), mRNA.	pcDNA3.1-C-(k)DYK or customized vector	in pcDNA3.1-C-(k)DYK	$49.50-$69.30 $99.00

ORF Online Only Promotion

Next-day Shipping ORF Clones ( in default vector with tag)
1 Clone	30% OFF
2-4 Clone	40% OFF
5 or more Clone	50% OFF
All Other ORF Clones
30% OFF

*Business Day

** You may select a custom vector to replace pcDNA3.1+/C-(K)DYK after clone is added to cart.

** GenScript guarantees 100% sequence accuracy of all synthetic DNA constructs we deliver, but we do not guarantee protein expression in your experimental system. Protein expression is influenced by many factors that may vary between experiments or laboratories. In addition, please pay attention to the signal peptide, propeptide and transit peptide in target ORF, which may affect the choice of vector (N/C terminal tag vector).

***One clone ID might be correlated to multiple accession numbers, which share the same CDS sequence.

Reference Sequences (Refseq)

BAGE ( NM_001187.1 ) cDNA ORF clone, Homo sapiens(human) -> NP_001178.1 Homo sapiens B melanoma antigen (BAGE), mRNA.

Price & Availability↑

CloneID	OHu29352
Clone ID Related Accession (Same CDS sequence)	NM_001187.1
Accession Version	NM_001187.1 Latest version!	Documents for ORF clone product in default vector
Sequence Information	ORF Nucleotide Sequence (Length: 132bp) Protein sequence SNP
Vector	pcDNA3.1-C-(k)DYK or customized vector	User Manual
Clone information	Clone Map	MSDS
Tag on pcDNA3.1⁺/C-(K)DYK	C terminal DYKDDDDK tags
ORF Insert Method	CloneEZ™ Seamless cloning technology
Insert Structure	linear
Update Date	2019-09-22
Organism	Homo sapiens(human)
Product	B melanoma antigen 1 precursor
Comment	Comment: REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U19180.1. ##Evidence-Data-START## Transcript exon combination :: U19180.1 [ECO:0000332] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END##

1
61
121

ATGGCGGCCA GAGCGGTTTT TCTGGCATTG TCTGCCCAGC TGCTCCAAGC CAGGCTGATG 
AAGGAGGAGT CCCCTGTGGT GAGCTGGAGG TTGGAGCCTG AAGACGGCAC AGCTCTGTGC 
TTCATCTTCT GA

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

RefSeq	NP_001178.1
CDS	201..332
Translation	MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF

Target ORF information:

RefSeq Version	NM_001187.1
Organism	Homo sapiens(human)
Definition	Homo sapiens B melanoma antigen (BAGE), mRNA.

Target ORF information:

Epitope	DYKDDDDK
Bacterial selection	AMP^R
Mammalian selection	Neo^R
Vector	pcDNA3.1⁺/C-(K)DYK

NM_001187.1

ORF Insert Sequence:

1
61
121

ATGGCGGCCA GAGCGGTTTT TCTGGCATTG TCTGCCCAGC TGCTCCAAGC CAGGCTGATG 
AAGGAGGAGT CCCCTGTGGT GAGCTGGAGG TTGGAGCCTG AAGACGGCAC AGCTCTGTGC 
TTCATCTTCT GA

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

PubMed

Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.
BMC cancer10163(2010 Apr)
Zhang S,Zhou X,Yu H,Yu Y

BAGE hypomethylation, a new epigenetic biomarker for colon cancer detection.
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology17(6)1374-9(2008 Jun)
Grunau C,Brun ME,Rivals I,Selves J,Hindermann W,Favre-Mercuret M,Granier G,De Sario A

Frequent DNA hypomethylation of human juxtacentromeric BAGE loci in cancer.
Genes, chromosomes & cancer43(1)11-24(2005 May)
Grunau C,Sanchez C,Ehrlich M,van der Bruggen P,Hindermann W,Rodriguez C,Krieger S,Dubeau L,Fiala E,De Sario A

BAGE genes generated by juxtacentromeric reshuffling in the Hominidae lineage are under selective pressure.
Genomics81(4)391-9(2003 Apr)
Ruault M,Ventura M,Galtier N,Brun ME,Archidiacono N,Roiz?s G,De Sario A

New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.
European journal of human genetics : EJHG10(12)833-40(2002 Dec)
Ruault M,van der Bruggen P,Brun ME,Boyle S,Roiz?s G,De Sario A