Tau peptide (337-368) (Repeat4 domain)

Tau peptide (337-368) (Repeat4 domain)

Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
RP30886
¥12,000.00

Ask us a question
Description

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.

Overview
Synonyms Tau peptide (337-368) (Repeat4 domain)
Description TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence
{Val}{Glu}{Val}{Lys}{Ser}{Glu}{Lys}{Leu}{Asp}{Phe}{Lys}{Asp}
{Arg}{Val}{Gln}{Ser}{Lys}{Ile}{Gly}{Ser}{Leu}{Asp}{Asn}{Ile}
{Thr}{His}{Val}{Pro}{Gly}{Gly}{Gly}{Asn}
Sequence Shortening VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Molecular Formula C₁₅₀H₂₄₈N₄₄O₅₀
Molecular Weight 3467.89

Properties
Length 32
Purity >95%
Solubility Soluble in Ultrapure water under 1mg/ml
Form Lyophilized
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.