Catalog Peptides » SARS-CoV-2 Spike Glycoprotein RBD B.1.617.2-Delta

SARS-CoV-2 Spike Glycoprotein RBD B.1.617.2-Delta

This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.2, India, Delta) covering the following mutations: L0452R and T0478K for T cell assays (e.g. ELISPOT).
RP30034
¥59,269.00

Ask us a question
Overview
Description This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.2, India, Delta) covering the following mutations: L0452R and T0478K for T cell assays (e.g. ELISPOT).
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQ
PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Properties
Source Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.617.2) Spike glycoprotein - Receptor-binding domain (covering the following mutations: L0452R and T0478K).
Gene ID S
Length 223 aa
Purity Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
Solubility Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system.
Form Lyophilized
Storage Store at -20°C.
Note The peptides of this product are supplied as trifluoroacetate salts.

Please note that we do not provide HPLC and MS reports for each individual peptide within our peptide library products.