Catalog Peptides » SARS-CoV-2 Spike Glycoprotein RBD B.1.617.1-Kappa

SARS-CoV-2 Spike Glycoprotein RBD B.1.617.1-Kappa

This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.1, India, Kappa) covering the following mutations: L0452R and E0484Q for T cell assays (e.g. ELISPOT).
RP30032
¥60,567.00

Ask us a question
Description

This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.1, India, Kappa) covering the following mutations: L0452R and E0484Q for T cell assays (e.g. ELISPOT).

Note

The peptides of this product are supplied as trifluoroacetate salts.

Overview
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSTPCNGVQGFNCYFPLQSYGFQ
PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Properties
Source Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.617.1) Spike glycoprotein - Receptor-binding domain (covering the following mutations: L0452R and E0484Q).
Gene ID S
Length 223 aa
Purity Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
Solubility Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system.
Storage Store at -20°C.

Please note that we do not provide HPLC and MS reports for each individual peptide within our peptide library products.